reconstitution comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-11-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
Misconceptions about lyophilization include the idea that dried products are indefinitely stable or that vacuum sealing eliminates all degradation. Chemical reactions can continue in the solid state, and some proteins lose activity even at low moisture. Another misconception is that any freeze-dryer cycle can be scaled by time alone; heat and mass transfer differ with equipment and load. Open questions remain about predicting long-term stability from short accelerated studies, particularly for amorphous formulations. Real-time stability data remain the standard for shelf-life assignment.
After lyophilization, the dried product is often sealed under vacuum or an inert gas to limit moisture and oxygen exposure. Vials, stoppers, and seals must maintain their barrier throughout shelf life. Storage temperature depends on product sensitivity: some cakes tolerate controlled room temperature, while labile biologics require refrigeration. Humidity is a critical variable because dried cakes are hygroscopic and can absorb water when exposed to air. Handling procedures therefore limit open-vial time and use desiccated environments for sampling.
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
Lyophilization, also called freeze-drying, is a dehydration process in which a solvent, usually water, is frozen and then removed by sublimation under reduced pressure. The method preserves heat-sensitive materials that would degrade in conventional drying. Large-scale use grew during the mid-twentieth century for blood plasma and antibiotics, and it later expanded to vaccines, enzymes, foods, and advanced materials. The process produces a dry, porous solid that usually reconstitutes rapidly. It is distinct from simple evaporation because the solvent bypasses the liquid phase during primary removal.
| Property | Value | Notes |
|---|---|---|
| Appearance | Porous, uniform cake or powder | Collapsed or shrunken cakes indicate process issues. |
| Reconstitution time | Seconds to several minutes | Depends on cake porosity, excipients, and diluent. |
| Residual moisture | 0.5-3% w/w | Product-specific; measured by Karl Fischer titration. |
| Typical storage temperature | 2-25 °C | Some biologics require 2-8 °C. |
| Container closure | Glass vial with elastomeric stopper | Sealed under vacuum or inert gas. |
Reconstitution involves adding a suitable diluent, often sterile water or a buffer, to the dried cake. Gentle swirling or inversion helps dissolve the material without creating excessive foam. The time required for complete dissolution can range from seconds to several minutes and depends on the cake structure and the diluent. Improper reconstitution, such as vigorous shaking or using the wrong diluent, can cause protein aggregation or loss of activity. After reconstitution, the product may have a limited shelf life and should be used according to its labeling.
Lyophilized products are typically hygroscopic and require protection from moisture during storage. Manufacturers seal them in glass vials, often under vacuum or an inert gas such as nitrogen. The container closure system, including the stopper and crimp seal, must prevent water vapor ingress. Storage temperature varies from controlled room temperature to refrigerated or frozen conditions, depending on the formulation. Humidity-controlled environments are essential because even brief exposure to ambient air can degrade the product.
Stability of a lyophilized product depends on its glass transition temperature, the temperature at which the amorphous cake transitions from a glassy to a rubbery state. Storage below this temperature minimizes molecular mobility and slows chemical degradation. If the storage temperature exceeds the glass transition temperature, the cake may collapse, shrink, or become sticky. Accelerated stability studies at elevated temperatures and humidity help predict shelf life, but they do not always reflect real-time behavior. Residual moisture content also plays a critical role in long-term stability.
The physical chemistry of freezing influences whether a formulation forms an amorphous glass or a crystalline solid. Amorphous systems can collapse if product temperature rises above the glass transition temperature of the freeze concentrate. Crystalline systems may show eutectic melting, where ice and solute melt together at a fixed temperature. Formulators add bulking agents, lyoprotectants, and buffers to preserve structure and biological activity. The optimum cycle keeps product temperature below critical thresholds during primary drying while allowing efficient sublimation.
Lyophilization is a dehydration process that removes water from a frozen material by sublimation under low pressure. The material is first frozen so that water becomes ice; then the surrounding pressure is lowered below the vapor pressure of ice. Heat is applied gently so ice changes directly to vapor without passing through a bulk liquid phase. The vapor is collected on a cold condenser, leaving a dry porous matrix. This process differs from simple evaporation because the material remains frozen during the main drying stage.
The process usually has three stages: freezing, primary drying, and secondary drying. Freezing sets the ice crystal structure and can determine pore size in the final cake. Primary drying removes free ice by sublimation at low pressure and low shelf temperature. Secondary drying removes bound water by raising the shelf temperature, although some water may remain as part of the solid. Cycle parameters depend on formulation, fill volume, vial type, and equipment performance.
Quality control also examines cake structure, color, and reconstitution behavior. A collapsed or shrunken cake can indicate a thermal excursion during drying. Analytical methods such as X-ray diffraction, differential scanning calorimetry, and near-infrared spectroscopy can detect crystallinity or moisture distribution. Regulatory expectations focus on validated assays and lot-to-lot consistency. Questions remain about how well accelerated stability tests predict long-term behavior for every formulation. Visual inspection remains common but is subjective without trained reviewers and reference images.
After lyophilization, a product's quality depends on residual moisture, cake appearance, and reconstitution time. Residual moisture is often measured by Karl Fischer titration or thermogravimetric analysis. A low moisture content can slow chemical degradation, but overly dry cakes may be brittle or slow to dissolve. Stability studies track these attributes over months under defined temperature and humidity conditions. Batch records link these measurements to specific process runs and help identify trends before a product fails specification.
Storage conditions for dried products usually aim to exclude moisture and oxygen. Vials are sealed under vacuum or with an inert gas, and stoppers must maintain a barrier during transport. Temperature recommendations vary; some materials remain stable at room temperature, while others need refrigeration or frozen storage. Humidity control is critical because dried cakes can absorb water rapidly once a container is opened. Desiccant packs and moisture-barrier bags add further protection during shipping.
Freezing is the first stage and sets the ice structure that later becomes the pore network. The formulation is cooled below its freezing point, often with a controlled ramp, and solutes concentrate as ice forms. Primary drying then lowers chamber pressure and supplies heat to sublime the ice. The product temperature must stay below its collapse or eutectic temperature to prevent structural loss. Secondary drying raises the temperature modestly to remove bound water and achieve a low residual moisture.
A freeze-dryer consists of a vacuum chamber, temperature-controlled shelves, a condenser, and a vacuum pump. Vials, ampoules, or bulk trays hold the product during the cycle. The condenser traps water vapor as ice at a temperature lower than the product. Cycle development balances shelf temperature, chamber pressure, and time. Scale-up can be difficult because heat and mass transfer change with equipment size, so process analytical tools and conservative validation are often used.
Lyophilization is a dehydration technique in which a product is frozen and the solvent is removed under reduced pressure. The low pressure allows ice to sublimate directly into vapor without passing through a bulk liquid phase. This differs from conventional drying, where heat drives evaporation and can damage heat-sensitive structures. The process is used for biological materials, pharmaceutical formulations, and some foods. Its main advantage is preservation of porous structure and rapid reconstitution.
== Overdose == Vosilasarm has been assessed in clinical trials in women with breast cancer at doses ranging from 50 to 150 mg/day, with the maximum safe and tolerated dose being 100 mg/day. The drug sold via black-market Internet suppliers and used non-medically has been reported to be taken at doses of 5 to 30 mg/day, with unknown adverse effects and risks.
APHL works with public health partners to build the foundation for quality testing, comprehensive standards and integrated public health laboratory systems. One of the initiatives, the Laboratory System Improvement Program, provides individual assessments of public health laboratory systems that include engaging stakeholders for system improvement, performance, implementation of strategies and continual evaluation. APHL also collaborates on the National Laboratory System project to build a public-private network of laboratories nationwide. APHL monitors trends in public health laboratory diagnostics, personnel and infrastructure in order to create quality assurance standards. By using these data points to benchmark individual labs against national norms, APHL is able to home in on key issues and help raise the standard of laboratory systems. Member labs have access to research and survey data online, which enables them to leverage new information quickly to identify promising strategies and practices.
Originally a modification for Half-Life, the development team was hired by Valve in 2000, when the company acquired the rights to Counter-Strike. The game received a port to Xbox in 2003. It was also ported to OS X and Linux in the form of a beta in January 2013. A full release was published in April 2013.
==== Pyrometallurgical recovery ==== The pyrometallurgical method uses a high-temperature furnace to reduce the components of the metal oxides in the battery to an alloy of Co, Cu, Fe, and Ni. This is the most common and commercially established method of recycling and can be combined with other similar batteries to increase smelting efficiency and improve thermodynamics. The metal current collectors aid the smelting process, allowing whole cells or modules to be melted at once. The product of this method is a collection of metallic alloy, slag, and gas. At high temperatures, the polymers used to hold the battery cells together burn off and the metal alloy can be separated through a hydrometallurgical process into its separate components. The slag can be further refined or used in the cement industry. The process is relatively risk-free and the exothermic reaction from polymer combustion reduces the required input energy. However, in the process, the plastics, electrolytes, and lithium salts will be lost.
=== East Africa === Italy joined the war on Germany's side on 10 June 1940, opening the East African Campaign and the Desert War in North Africa. A Rhodesian-led force of irregulars from the Somaliland Camel Corps—based in British Somaliland, on the Horn of Africa's north coast—took part in one of the first clashes between British and Italian forces when it exchanged fire with an Italian banda (irregular company) around dawn on 11 June. Two days later three Caproni bombers of the Regia Aeronautica attacked Wajir, one of No. 237 Squadron's forward airstrips, damaging two Rhodesian aircraft.
Sources: en.wikipedia.org
Polymyalgia rheumatica (PMR) is a systemic inflammatory disease characterized by pain or stiffness, usually in the neck, shoulders, upper arms, and hips, but which may occur all over the body. Almost all cases occur in people age 50 or older. Pain and stiffness of PMR is worse in the morning and improves throughout the day, but these symptoms frequently persist to some extent throughout the day and into the evening. People who have polymyalgia rheumatica may also have temporal arteritis (giant cell arteritis), an inflammation of blood vessels in the face which can cause blindness if not treated quickly. The pain and stiffness can result in a lowered quality of life, and can lead to depression. The exact cause of PMR, including whether or not it may be an autoimmune disease, is unclear. Persons of Northern European descent are at greater risk. There is no definitive laboratory test, but C-reactive protein (CRP) and erythrocyte sedimentation rate (ESR) can be useful as non-specific markers of systemic inflammation. PMR is usually treated with corticosteroids taken by mouth. Most people need to continue the corticosteroid treatment for two to three years. PMR sometimes goes away on its own in a year or two, but medications and self-care measures (e.g., eating the recommended amount of fruits and vegetables) can improve the rate of recovery. PMR was first established as a distinct disease in 1966 by a case report on 11 patients at Mount Sinai Hospital in New York City. It takes its name from the Greek word Πολυμυαλγία polymyalgia, which means "pain in many muscles".
=== Nausea and vomiting === Intravenous dexamethasone is effective for the prevention of nausea and vomiting in people who had surgery and whose post-operative pain was treated with long-acting spinal or epidural spinal opioids. The combination of dexamethasone and a 5-HT3 receptor antagonist such as ondansetron is more effective than a 5-HT3 receptor antagonist alone in preventing postoperative nausea and vomiting.
He was highly praised for his debut season with Melbourne with the Australian Associated Press' Michael Ramsey writing Hibberd was almost certainly Melbourne's most valuable addition. The Herald Sun's Rebecca Williams and AFL Media's Ben Guthrie furthered this notion by stating he had proven to be one of the top recruits in the league. In addition, The Age reporter, Anthony Colangelo, said Hibberd was one of "Melbourne's best and most important players in their charge up the ladder." His season was rewarded with his first All-Australian selection, where he was named in the back pocket, he was one of three Melbourne nominees for the Leigh Matthews Trophy, and was named in AFL Media's team of the week a further three times after his debut for Melbourne. Despite being one of the favourites to win the best and fairest at Melbourne, he ultimately finished sixth in the award. He received international honours at the end of the season when he represented Australia in the International Rules Series against Ireland in November.
=== Early student activism: 1966–1968 === Biko was initially interested in studying law at university, but many of those around him discouraged this, believing that law was too closely intertwined with political activism. Instead they convinced him to choose medicine, a subject thought to have better career prospects. He secured a scholarship, and in 1966 entered the University of Natal Medical School. There, he joined what his biographer Xolela Mangcu called "a peculiarly sophisticated and cosmopolitan group of students" from across South Africa; many of them later held prominent roles in the post-apartheid era. The late 1960s was the heyday of radical student politics across the world, as reflected in the protests of 1968, and Biko was eager to involve himself in this environment. Soon after he arrived at the university, he was elected to the Students' Representative Council (SRC). The university's SRC was affiliated with the National Union of South African Students (NUSAS). NUSAS had taken pains to cultivate a multi-racial membership but remained white-dominated because the majority of South Africa's students were from the country's white minority. As Clive Nettleton, a white NUSAS leader, put it: "the essence of the matter is that NUSAS was founded on white initiative, is financed by white money and reflects the opinions of the majority of its members who are white". NUSAS officially opposed apartheid, but it moderated its opposition in order to maintain the support of conservative white students.
=== Pharmacodynamics === Methenamine has non-specific antiseptic and antibacterial properties in acidic environments via hydrolysis into formaldehyde. Formaldehyde is an aldehyde and is highly reactive and thereby bactericidal. It acts by binding to and denaturing bacterial proteins and nucleic acids. Methenamine is almost completely inactive as an antibacterial in alkaline environments, in which it is not degraded into formaldehyde. The drug's spectrum of antibacterial activity includes all urinary tract pathogens. It is specifically effective against common UTI-causing bacteria including Staphylococcus saprophyticus, Escherichia coli, Enterococcus faecalis, and Enterococcus faecium. However, Klebsiella aerogenes (Enterobacter aerogenes) has been said to generally be resistant to methenamine, although the mechanism and rationale supporting this resistance have not been described. In addition, certain urea-splitting bacteria, such as Proteus and Pseudomonas species, can make the urine more alkaline, thereby potentially inhibiting the antibacterial effects of methenamine. Providencia and Morganella species are also urea-splitting and might likewise be resistant to methenamine, although this topic requires more research. Methenamine is provided medically as the hippuric acid or mandelic acid salt, and the acid salt component plays a key role in helping to make the urine more acidic such that the activity of methenamine is optimized. Ascorbic acid (vitamin C), sodium acid phosphate, or ammonium chloride can also be supplemented to further acidify the urine.
Sources: en.wikipedia.org
Later on, grandmothers can again provide more direct care for the infant. These techniques require the mother's commitment over a period of weeks or months. However, even when lactation is established, the supply may not be large enough to breastfeed exclusively. A supportive social environment improves the likelihood of success. As the mother's milk production increases, other feeding can decrease. Parents and other family members should watch the baby's weight gain and urine output to assess nutritional adequacy. A WHO manual for physicians and senior health workers, citing a 1992 source, states: "If a baby has been breastfeeding sometimes, the breastmilk supply increases in a few days. If a baby has stopped breastfeeding, it may take 1–2 weeks or more before much breastmilk comes." Induced lactation, also called adoptive lactation, is the process of starting breastfeeding in a woman who did not give birth. This usually requires the adoptive mother to take hormones and other drugs to stimulate breast development and promote milk production. In some cultures, breastfeeding an adoptive child creates milk kinship that builds community bonds across class and other hierarchical bonds.
==== 2011–2018: Rebuilding, return of trophies, and departure ==== Wenger's preparations for the 2011–12 season were disrupted by player unrest. Though he insisted none of his top players would leave the club, Fàbregas eventually moved to Barcelona, while Gaël Clichy and Samir Nasri joined Manchester City. Suspensions and injuries left Wenger fielding an understrength side against Manchester United on 29 August 2011; Arsenal were trounced 8–2, which represented their worst defeat in 115 years. Needing to address the squad's lack of depth, Wenger completed a series of deals in the final days of the summer transfer window. He mostly brought in experienced players, such as Yossi Benayoun on loan from Chelsea, Everton's Mikel Arteta and Germany international Per Mertesacker. By October, Arsenal had made their worst start to a season in 58 years, losing four of their opening seven matches. However, the team soon harmonised and, in the same month, club captain Robin van Persie scored a hat-trick as Arsenal beat Chelsea 5–3. Despite another season of no silverware, Wenger guided Arsenal to third position in the Premier League, thus qualifying for the Champions League for a 15th successive campaign. Van Persie had scored 37 goals, in his first injury-free season for the club. He, however, grew disillusioned with Arsenal's transfer policy, and decided not to renew his contract, with one year remaining. When Manchester United manager Sir Alex Ferguson learnt of the situation, he called Wenger to push through a deal and Van Persie agreed to join Manchester United in August 2012.
The Wall Street Journal reported that several US Navy destroyers entered the Strait of Hormuz for the first time since the war began. A US official described the event as an "operation that focused on freedom of navigation through International waters”. Iranian government reportedly threatened to attack the ships, accusing US of ceasefire violation. US CENTCOM said the ships are taking part in mine clearance operations. JD Vance announced that the talks between the US and Iran had failed, as he was unable to reach an agreement after a day of negotiations. Afterwards, Trump declared a naval blockade on the Strait of Hormuz, announcing that the US Navy will prevent ships from entering or exiting the Strait and intercept vessels that have paid tolls to Iran. US CENTCOM announced that the blockade will be enforced on vessels of all nations entering or departing Iranian ports and coastal areas but "will not impede freedom of navigation for vessels transiting the Strait of Hormuz to and from non-Iranian ports." The IRGC Navy said that any military vessel approaching the strait would be considered a ceasefire violation and would meet a "severe response." On 21 April, US Senator Lindsey Graham praised the decision to leave the naval blockade in place, saying that it will be a source of pressure for the Iranian government. He also set out strict conditions for any potential agreement with Iran. On 12 May, ahead of his state visit to China, Trump was asked by a reporter about the extent to which he cared about Americans' financial situations while in negotiations with Iran.
A hump is a round mass of fat or muscle that occurs naturally in many animal species, especially in mammals. Humps often serve as fat reserves, allowing the animal to survive without food for extended periods of time. A hump can also help an animal to regulate body heat in hot climates. Some humps consist of muscle instead of fat, which can help the animal dig through hard soil, hold up a heavy head, or maneuver around in snow.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
No. Freeze-drying removes water but does not reliably kill microorganisms. Sterile lyophilized products are typically prepared aseptically before freezing or are sterilized by a validated method. Microbial control depends on the entire manufacturing process.
Storage temperature is set by the least stable component in the formulation. Proteins, vaccines, and some small molecules can degrade faster at higher temperatures. Refrigeration slows these changes but does not stop them completely.
Collapse occurs when the product exceeds its collapse or glass transition temperature during drying. The ice structure then loses support, and the cake may shrink, melt back, or become dense. Formulation and cycle adjustments are used to keep the product below that threshold.
Yes. Lyophilization and freeze-drying are synonyms for the same vacuum-assisted sublimation process. The term lyophilization is more common in pharmaceutical and laboratory settings, while freeze-drying is widely used in food and general contexts.