A practical reference on sublimation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-10-01. Anything still debated is marked as such rather than presented as settled.
Lyophilization, also known as freeze-drying, is a process that removes water from a material by freezing it and then reducing pressure to allow ice to sublimate directly into vapor. The method begins with a freezing step that solidifies the water content. Next, primary drying lowers the pressure below the triple point of water, enabling sublimation without passing through a liquid phase. A final secondary drying step removes bound water through desorption. This sequence produces a dry, porous cake that can be reconstituted later.
The process relies on the phase diagram of water, where the triple point marks the conditions at which ice, liquid water, and vapor coexist. By maintaining pressure below this point, typically around 0.01 to 0.1 millibar, sublimation becomes the dominant mechanism. Formulations often include excipients such as sugars or polymers that act as lyoprotectants and bulking agents. These additives help preserve the structure of the active ingredient and prevent collapse during drying. The choice of excipient and freezing rate influences the final cake morphology and stability.
The process generally proceeds in three stages: freezing, primary drying, and secondary drying. During freezing, controlled cooling converts water into ice and may also crystallize or vitrify solutes. In primary drying, the pressure is lowered below the triple point, and heat is supplied so ice sublimes directly to vapor. Secondary drying removes water that remains bound to the solid matrix, yielding a low final water content. Product temperature must stay below the collapse or glass transition temperature to maintain structure. Cycle design therefore balances shelf temperature, chamber pressure, and time.
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
| Property | Value | Notes |
|---|---|---|
| Common name | Freeze-drying | Lyophilization is the technical synonym. |
| Typical chamber pressure | 0.01–0.1 mbar | Below the triple point of water. |
| Primary drying temperature | −40 to −10 °C | Depends on formulation and equipment. |
| Residual moisture | 1–5% | Target for many pharmaceutical products. |
| Typical equipment | Vacuum freeze-dryer | Includes drying chamber and condenser. |
The physics of lyophilization couples heat transfer, mass transfer, and phase behavior. Sublimation requires a vapor pressure difference between the ice front and the chamber, and the dried layer adds resistance to vapor flow. Amorphous formulations are characterized by a glass transition temperature of the maximally freeze-concentrated solute, often denoted Tg'. Crystalline bulking agents can provide structure, while amorphous excipients stabilize labile components. Open questions remain about spatial heterogeneity, edge effects, and how laboratory cycles scale to production.
Lyophilization is a drying process in which a solvent, usually water, is removed from a frozen material by sublimation under reduced pressure. The material is first solidified, then placed under vacuum so that ice transitions directly to vapor without a bulk liquid phase. This approach suits heat-sensitive substances that would degrade during conventional evaporation. Primary drying removes unbound ice, while secondary drying reduces water that remains adsorbed to the solid matrix. The result is a porous, lightweight solid that can be reconstituted later.
A typical cycle begins with freezing, sometimes including an annealing step to control ice crystal size. Freezing conditions influence the pore network that later allows vapor escape. During primary drying, shelf temperature and chamber pressure are set so heat enters the product while its temperature stays below the collapse or eutectic point. Secondary drying then raises the shelf temperature to desorb bound water and lower residual moisture. Cycle design depends on formulation, fill volume, container type, and equipment capability.
A typical cycle begins with freezing, which fixes the material into a solid and determines ice crystal size. Primary drying then raises heat under vacuum so ice sublimes, often near or below the collapse temperature of the formulation. Secondary drying removes bound water that remains after ice is gone, usually by gently warming the product. Each stage balances heat input against pressure to avoid melting or structural damage. Temperature probes and pressure sensors guide the transition between stages.
In practice, lyophilization is slower and more energy intensive than simple drying. Cycle times can range from hours to several days depending on load, container, and formulation. Amorphous materials may require excipients that help preserve structure during freezing and drying. The method is widely used for biological materials, pharmaceuticals, and foods where heat drying would cause unacceptable change. Open questions remain about scaling cycles between laboratory and production equipment, and this gap affects technology transfer.
==== Entrapment of catalytically active noble metal nanoparticles ==== The entrapment of catalytically active noble metals can be accomplished by grafting on functional groups to the unsaturated metal site on MOFs. Ethylenediamine (ED) has been shown to be grafted on the Cr metal sites and can be further modified to encapsulate noble metals such as Pd. The entrapped Pd has similar catalytic activity as Pd/C in the Heck reaction. Ruthenium nanoparticles have catalytic activity in a number of reactions when entrapped in the MOF-5 framework. This Ru-encapsulated MOF catalyzes oxidation of benzyl alcohol to benzaldehyde, although degradation of the MOF occurs. The same catalyst was used in the hydrogenation of benzene to cyclohexane. In another example, Pd nanoparticles embedded within defective HKUST-1 framework enable the generation of tunable Lewis basic sites. Therefore, this multifunctional Pd/MOF composite is able to perform stepwise benzyl alcohol oxidation and Knoevenagel condensation.
== Conservative and radical replacements == Not all amino acid replacements have the same effect on function or structure of protein. The magnitude of this process may vary depending on how similar or dissimilar the replaced amino acids are, as well as on their position in the sequence or the structure. Similarity between amino acids can be calculated based on substitution matrices, physico-chemical distance, or simple properties such as amino acid size or charge (see also amino acid chemical properties). Usually amino acids are thus classified into two types:
==== Arrest and death ==== In 1977, Biko broke his banning order by travelling to Cape Town, hoping to meet Unity Movement leader Neville Alexander and deal with growing dissent in the Western Cape branch of the BCM, which was dominated by Marxists like Johnny Issel. Biko drove to the city with his friend Peter Jones on 17 August, but Alexander refused to meet with Biko, fearing that he was being monitored by the police. Biko and Jones drove back toward King William's Town, but on 18 August they were stopped at a police roadblock near Grahamstown. Biko was arrested for having violated the order restricting him to King William's Town. Unsubstantiated claims have been made that the security services were aware of Biko's trip to Cape Town and that the road block had been erected to catch him. Jones was also arrested at the roadblock; he was subsequently held without trial for 533 days, during which time he was interrogated on numerous occasions. The security services took Biko to the Walmer police station in Port Elizabeth, where he was held naked in a cell with his legs in shackles. On 6 September, he was transferred from Walmer to room 619 of the security police headquarters in the Sanlam Building in central Port Elizabeth, where he was interrogated for 22 hours, handcuffed and in shackles, and chained to a grille. Exactly what happened has never been ascertained, but during the interrogation he was severely beaten by at least one of the ten security police officers. He suffered three brain lesions that resulted in a massive brain haemorrhage on 6 September.
Ibutilide is a Class III antiarrhythmic agent that is indicated for acute cardioconversion of atrial fibrillation and atrial flutter of a recent onset to sinus rhythm. It exerts its antiarrhythmic effect by induction of slow inward sodium current, which prolongs action potential and refractory period of myocardial cells. Because of its Class III antiarrhythmic activity, there should not be concomitant administration of Class Ia and Class III agents. Ibutilide is marketed as Corvert by Pfizer. Administration resulted in successful heart rhythm control in 31–44% of patients within 90 minutes, with sustained polymorphic ventricular tachycardia in 0.9–2.5% of patients. It appears to show better results in atrial flutter as compared to atrial fibrillation.
Sources: en.wikipedia.org
During the Second World War he was a member of Churchill's Scientific Committee on Food Policy and helped to formulate food rationing Boyd Orr was knighted in the 1935 New Year Honours for services to agriculture.
In the Congress of the Yugoslav League of Communists in 1990, Milosević and his subordinate representatives for Vojvodina, Kosovo and the Socialist Republic of Montenegro attempted to silence opposition from the Socialist Republic of Slovenia who opposed the actions taken against Kosovo Albanian leadership, by blocking all reforms proposed by the Slovene representatives. The tactic failed and Slovenia, along with its ally Croatia, abdicated from the Yugoslav Communist Party. This caused the Yugoslav Communist party to fall apart, and then the state of Yugoslavia itself one year later.
Observed by humans since the dawn of history, the behaviour of ants has been documented and the subject of early writings and fables passed from one century to another. Those using scientific methods, myrmecologists, study ants in the laboratory and in their natural conditions. Their complex and variable social structures have made ants ideal model organisms. Ultraviolet vision was first discovered in ants by Sir John Lubbock in 1881. Studies on ants have tested hypotheses in ecology and sociobiology, and have been particularly important in examining the predictions of theories of kin selection and evolutionarily stable strategies. Ant colonies may be studied by rearing or temporarily maintaining them in formicaria, specially constructed glass framed enclosures. Individuals may be tracked for study by marking them with dots of colours. The successful techniques used by ant colonies have been studied in computer science and robotics to produce distributed and fault-tolerant systems for solving problems, for example Ant colony optimization and Ant robotics. This area of biomimetics has led to studies of ant locomotion, search engines that make use of "foraging trails", fault-tolerant storage, and networking algorithms.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
2 Al + 3 S → Al2S3 This reaction is extremely exothermic and it is not necessary or desirable to heat the whole mass of the sulfur-aluminum mixture; (except possibly for very small amounts of reactants). The product will be created in a fused form; it reaches a temperature greater than 1,100 °C and may melt its way through steel. The cooled product is very hard.
Sources: en.wikipedia.org
Conventional drying uses heat to evaporate water from a material, while lyophilization freezes the material and removes water by sublimation under vacuum. This avoids the liquid phase and reduces thermal damage to sensitive substances. The result is a porous cake that reconstitutes quickly.
A vacuum lowers the pressure below the triple point of water, allowing ice to sublimate directly into vapor without melting. It also removes water vapor from the product chamber and speeds up the drying process. Without vacuum, the ice would melt rather than sublimate.
Not all substances are suitable for lyophilization. Materials must form a stable frozen matrix and tolerate freezing and low pressure. Some small molecules, oils, or volatile compounds may not form a proper cake or may be lost during processing.
Yes. Lyophilization and freeze-drying are synonyms for the same vacuum-assisted sublimation process. The term lyophilization is more common in pharmaceutical and laboratory settings, while freeze-drying is widely used in food and general contexts.