If you have been reading about lyoprotectant and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-11-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilization, also known as freeze-drying, is a process that removes water from a material by freezing it and then reducing pressure to allow ice to sublimate directly into vapor. The method begins with a freezing step that solidifies the water content. Next, primary drying lowers the pressure below the triple point of water, enabling sublimation without passing through a liquid phase. A final secondary drying step removes bound water through desorption. This sequence produces a dry, porous cake that can be reconstituted later.
The process relies on the phase diagram of water, where the triple point marks the conditions at which ice, liquid water, and vapor coexist. By maintaining pressure below this point, typically around 0.01 to 0.1 millibar, sublimation becomes the dominant mechanism. Formulations often include excipients such as sugars or polymers that act as lyoprotectants and bulking agents. These additives help preserve the structure of the active ingredient and prevent collapse during drying. The choice of excipient and freezing rate influences the final cake morphology and stability.
Quality assessment of a lyophilized product includes cake appearance, residual moisture, reconstitution time, and container closure integrity. A uniform, porous cake suggests that freezing and drying stayed within the formulation's design space. Cracks, shrinkage, meltback, or a glassy film can indicate thermal abuse or a formulation problem. Analysts also test for subvisible particles and sterility when the product requires those specifications. Visual inspection alone cannot confirm biological activity or chemical stability, so it is combined with analytical methods.
Stability programs monitor lyophilized products under defined temperature and humidity conditions over time. Real-time studies at recommended storage conditions are the reference, while accelerated studies provide early signals of degradation pathways. Because a dry cake can still undergo oxidation, hydrolysis, or aggregation, stability depends on residual moisture, excipients, and container headspace. Open questions include how best to predict long-term stability from short accelerated runs and how vial-to-vial variability affects shelf life. Current guidance treats these predictions as product-specific rather than universally generalizable.
| Property | Value | Notes |
|---|---|---|
| Common name | Freeze-drying | Lyophilization is the technical synonym. |
| Typical chamber pressure | 0.01–0.1 mbar | Below the triple point of water. |
| Primary drying temperature | −40 to −10 °C | Depends on formulation and equipment. |
| Residual moisture | 1–5% | Target for many pharmaceutical products. |
| Typical equipment | Vacuum freeze-dryer | Includes drying chamber and condenser. |
In practice, lyophilization is slower and more energy intensive than simple drying. Cycle times can range from hours to several days depending on load, container, and formulation. Amorphous materials may require excipients that help preserve structure during freezing and drying. The method is widely used for biological materials, pharmaceuticals, and foods where heat drying would cause unacceptable change. Open questions remain about scaling cycles between laboratory and production equipment, and this gap affects technology transfer.
Lyophilization removes water by freezing a material and then lowering pressure so ice changes directly to vapor. The process relies on sublimation, the phase transition from solid to gas without an intermediate liquid state. Because the material remains frozen during primary drying, the structure often stays porous. This porous matrix can rehydrate quickly when water is added back. The low pressure also allows vapor to leave the solid matrix without boiling.
A typical cycle begins with freezing, which fixes the material into a solid and determines ice crystal size. Primary drying then raises heat under vacuum so ice sublimes, often near or below the collapse temperature of the formulation. Secondary drying removes bound water that remains after ice is gone, usually by gently warming the product. Each stage balances heat input against pressure to avoid melting or structural damage. Temperature probes and pressure sensors guide the transition between stages.
Analytical methods for lyophilized solids must account for the low moisture content and the fragile cake. Karl Fischer titration is widely used for water content, while near-infrared spectroscopy can measure moisture non-destructively in sealed containers. X-ray diffraction and modulated differential scanning calorimetry help identify crystalline or amorphous phases. Residual solvent analysis may be needed if organic solvents were used during formulation. The combination of these methods supports batch release and long-term stability assessment.
Lyophilized products are typically stored as sealed solids in vials or syringes. Moisture ingress is a major concern because many dried cakes are hygroscopic and can lose stability when exposed to humid air. Storage temperature depends on the formulation; some products are kept refrigerated, while others are stable at room temperature. Container closure integrity and headspace moisture are often monitored. Light protection may also be required for some photosensitive materials.
On the morning of March 10, examiners from the Federal Reserve and the Federal Deposit Insurance Corporation (FDIC) arrived at the offices of SVB to assess the company's finances. Several hours later, the California Department of Financial Protection and Innovation seized SVB citing inadequate liquidity and insolvency, and placed it into the receivership of the FDIC. The failure of SVB was the largest by assets of any bank since the 2008 financial crisis and the second-largest failure of an FDIC-insured bank. According to regulatory reports as of December 31, 2022, uninsured deposits were estimated to represent 89 percent of total deposits at the bank. With no other bank immediately offering to assume or guarantee them, the FDIC organized a Deposit Insurance National Bank of Santa Clara (DINB) to re-open the bank's branches the following Monday and enable access to insured deposits only. It announced that it would begin paying dividends for uninsured funds within the following week as SVB's assets were liquidated. Moody's Investor Service projected a recovery rate for uninsured depositors of 80–90 percent. The FDIC notified Silicon Valley Bank employees that they would be let go in 45 days' time; in the meantime, it offered salaried employees a 50% raise and hourly employees double pay for any overtime. The Federal Reserve Bank of San Francisco stated that the bank's CEO Greg Becker was no longer on its board of directors.
=== Pyrimidine catabolism === Cytosine and uracil are converted into beta-alanine, which is further processed into malonyl-CoA, a key precursor for fatty acid synthesis and other metabolic pathways. Thymine, on the other hand, is converted into β-aminoisobutyric acid, which is then used to form methylmalonyl-CoA. The remaining carbon skeletons, such as acetyl-CoA and succinyl-CoA, can be further oxidized in the citric acid cycle. Pyrimidine degradation ultimately results in the formation of ammonium, water, and carbon dioxide. The ammonium can then enter the urea cycle, which takes place in both the cytosol and mitochondria of cells. Pyrimidine bases can also be salvaged. For example, the uracil base can be combined with ribose-1-phosphate to form uridine monophosphate (UMP). A similar reaction occurs with thymine and deoxyribose-1-phosphate. Deficiencies in enzymes involved in pyrimidine catabolism can lead to diseases such as Dihydropyrimidine dehydrogenase deficiency, which causes neurological impairments.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
From the incorporation of Scarborough as a township in 1850, the head of the local government was a reeve who chaired the town council. In 1953, Scarborough and twelve other townships, towns, and villages in York County federated with the City of Toronto to form Metropolitan Toronto. Scarborough retained its own town council but an added layer of government, the Metropolitan Toronto Council, with the reeve of Scarborough having a seat. In 1967, Scarborough was incorporated as borough at which point the head of the local government was styled as mayor. A Board of Control, consisting of the mayor and four directly elected Controllers, was also created as an executive committee of Scarborough's council, whose members also sat on Metro Council. In 1973, Scarborough opened its new city hall, the Scarborough Civic Centre where the borough and later its city council met. In 1983, Scarborough attained city status, but its governing structure remained the same. In 1988, the Board of Control was abolished. In 1998, the municipalities of Metropolitan Toronto were dissolved and amalgamated into a single City of Toronto. Since then, Scarborough has been a community within the city of Toronto, and the head of the local government is the Mayor of Toronto and is governed by Toronto City Council. Community councils were formed to process issues considered local to their communities. Scarborough's community council, made up of the district's local councillors, meets once a month at the Civic Centre.
Sources: en.wikipedia.org
=== Severity (staging) and progression (grading) === The most recent (2017) periodontal disease classification uses CAL as a major factor in assessing both Severity and Progression. Alongside other factors like radiographic bone loss and tooth loss. CAL correlates to severity (Staging) as follows.
== Genetics == The McLeod phenotype is a recessive mutation of the Kell blood group system. The McLeod gene encodes the XK protein, which is located on the X chromosome, and has the structural characteristics of a membrane transport protein but an unknown function. Absence of the XK protein is an X-linked disease. Mutational variants result in McLeod syndrome either with or without neuroacanthocytosis: the gene on the X chromosome for McLeod syndrome is physically close to the gene for chronic granulomatous disease. As a result, an individual with one relatively small deletion may have both diseases. The phenotype may be present without the syndrome presenting.
Following the possibility of nicotine addiction from e-cigarette use, there is also concern children may start smoking traditional cigarettes in greater numbers as well, as youth who use e-cigarettes are more likely to go on to smoke cigarettes. Their part in tobacco harm reduction is unclear, while another review found they appear to have the potential to lower tobacco-related death and disease. Regulated US Food and Drug Administration nicotine replacement products may be safer than e-cigarettes, but e-cigarettes are generally seen as safer than combusted tobacco products. It is estimated their safety risk to users is similar to that of smokeless tobacco. The long-term effects of e-cigarette use are unknown. The risk from serious adverse events was reported in 2016 to be low. Less serious adverse effects include abdominal pain, headache, blurry vision, throat and mouth irritation, vomiting, nausea, and coughing. Nicotine itself is associated with some health harms. In 2019 and 2020, an outbreak of severe lung illness throughout the US was linked to the use of vaping products. E-cigarettes create vapor made of fine and ultrafine particles of particulate matter, which have been found to contain propylene glycol, glycerin, nicotine, flavors, small amounts of toxicants, carcinogens, and heavy metals, as well as metal nanoparticles, and other substances. Its exact composition varies across and within manufacturers, and depends on the contents of the liquid, the physical and electrical design of the device, and user behavior, among other factors.
== See also == Antioxidant – Compound that inhibits the oxidation of other molecules Advanced glycation endproduct – Proteins or lipids chemically altered by sugar exposurePages displaying short descriptions of redirect targets
==== India ==== Following the expiration of the semaglutide patent in India in March 2026, several domestic pharmaceutical companies launched generic versions of the drug for the treatment of type 2 diabetes and obesity. These included Sun Pharmaceutical Industries (Sematrinity and Noveltreat), Dr. Reddy's Laboratories (Obeda), Zydus Lifesciences (Alterme, Mashema and Semaglyn), Torrent Pharmaceuticals (Sembolic and Semalix), Alkem Laboratories (Semasize, Obesema and Hepaglide), Glenmark Pharmaceuticals (Glipiq) and Eris Lifesciences (Sundae). Others, including Natco Pharma (Semanat and Semafull) and Mankind Pharma also planned product launches around the same time, and in total, 40–50 total brands of semaglutide were expected to become available in India in the following months.
Sources: en.wikipedia.org
Conventional drying uses heat to evaporate water from a material, while lyophilization freezes the material and removes water by sublimation under vacuum. This avoids the liquid phase and reduces thermal damage to sensitive substances. The result is a porous cake that reconstitutes quickly.
A vacuum lowers the pressure below the triple point of water, allowing ice to sublimate directly into vapor without melting. It also removes water vapor from the product chamber and speeds up the drying process. Without vacuum, the ice would melt rather than sublimate.
Not all substances are suitable for lyophilization. Materials must form a stable frozen matrix and tolerate freezing and low pressure. Some small molecules, oils, or volatile compounds may not form a proper cake or may be lost during processing.
Many dried cakes are hygroscopic and can adsorb water during storage or handling. Absorbed moisture may lower the glass transition temperature and promote chemical reactions. Sealed packaging and controlled humidity reduce this risk.